SCOPe 2.08: Domain d2ruca1: 2ruc A:5-117

Lineage for d2ruca1 (2ruc A:5-117)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein Mitotic rotamase PIN1, domain 2 [54547] (2 species)
   Domain 1 is a WW-domain

7. Species Human (Homo sapiens) [TaxId:9606] [54548] (52 PDB entries)

8. Domain d2ruca1: 2ruc A:5-117 [261973]
   Other proteins in same PDB: d2ruca2
   automated match to d1nmwa_
   has additional insertions and/or extensions that are not grouped together

Details for d2ruca1

PDB Entry: 2ruc

PDB Description: Solution structure of the peptidyl prolyl cis-trans isomerase domain of human Pin1 with sulfate ion

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase NIMA-interacting 1

SCOPe Domain Sequences for d2ruca1:

Sequence; same for both SEQRES and ATOM records:

>d2ruca1 d.26.1.1 (A:5-117) Mitotic rotamase PIN1, domain 2 {Human (Homo sapiens) [TaxId: 9606]}
eparvrcshllvkhsqsrrpsswrqekitrtkeealelingyiqkiksgeedfeslasqf
sdcssakargdlgafsrgqmqkpfedasfalrtgemsgpvftdsgihiilrte

Timeline for d2ruca1:

• d2ruca1 first appeared in SCOPe 2.04, called d2ruca_
  
• d2ruca1 appears in SCOPe 2.07