SCOPe 2.04: Domain d4rixb_: 4rix B:

Lineage for d4rixb_ (4rix B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
   PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [82796] (44 PDB entries)
   Uniprot P00533 702-1018

8. Domain d4rixb_: 4rix B: [261968]
   automated match to d3ikaa_
   complexed with adp, anp, mg; mutant

Details for d4rixb_

PDB Entry: 4rix, 3.1 Å

PDB Description: Crystal structure of an EGFR/HER3 kinase domain heterodimer containing the cancer-associated HER3-Q790R mutation

PDB Compounds: (B:) Epidermal growth factor receptor

SCOPe Domain Sequences for d4rixb_:

Sequence, based on SEQRES records:

>d4rixb_ d.144.1.7 (B:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
lvepltpsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikel
reatspkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkd
nigsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeek
eyhaeggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissil
ekgerlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgd

Sequence, based on observed residues (ATOM records):

>d4rixb_ d.144.1.7 (B:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
lvepltpsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikel
reatspkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkd
nigsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeek
eyhavpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgd

Timeline for d4rixb_:

• d4rixb_ is new in SCOPe 2.04-stable
  
• d4rixb_ appears in SCOPe 2.05
  
• d4rixb_ appears in the current release, SCOPe 2.08