Lineage for d4rixb_ (4rix B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2542179Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2542180Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2542316Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2543502Protein EGF receptor tyrosine kinase, Erbb-1 [82795] (1 species)
    PTK group; EGFR subfamily; membrane spanning protein tyrosine kinase
  7. 2543503Species Human (Homo sapiens) [TaxId:9606] [82796] (109 PDB entries)
    Uniprot P00533 702-1018
  8. 2543588Domain d4rixb_: 4rix B: [261968]
    Other proteins in same PDB: d4rixa_, d4rixc_
    automated match to d3ikaa_
    complexed with adp, anp, mg; mutant

Details for d4rixb_

PDB Entry: 4rix (more details), 3.1 Å

PDB Description: Crystal structure of an EGFR/HER3 kinase domain heterodimer containing the cancer-associated HER3-Q790R mutation
PDB Compounds: (B:) Epidermal growth factor receptor

SCOPe Domain Sequences for d4rixb_:

Sequence, based on SEQRES records: (download)

>d4rixb_ d.144.1.7 (B:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
lvepltpsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikel
reatspkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkd
nigsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeek
eyhaeggkvpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissil
ekgerlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgd

Sequence, based on observed residues (ATOM records): (download)

>d4rixb_ d.144.1.7 (B:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]}
lvepltpsgeapnqallrilketefkkikvlgsgafgtvykglwipegekvkipvaikel
reatspkankeildeayvmasvdnphvcrllgicltstvqlitqlmpfgclldyvrehkd
nigsqyllnwcvqiakgmnyledrrlvhrdlaarnvlvktpqhvkitdfglakllgaeek
eyhavpikwmalesilhriythqsdvwsygvtvwelmtfgskpydgipaseissilekge
rlpqppictidvymimrkcwmidadsrpkfreliiefskmardpqrylviqgd

SCOPe Domain Coordinates for d4rixb_:

Click to download the PDB-style file with coordinates for d4rixb_.
(The format of our PDB-style files is described here.)

Timeline for d4rixb_: