Lineage for d4rqpo_ (4rqp O:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1812227Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 1812436Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 1813002Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 1813003Protein automated matches [190988] (10 species)
    not a true protein
  7. 1813012Species Enterovirus a71 [TaxId:39054] [261947] (8 PDB entries)
  8. 1813018Domain d4rqpo_: 4rqp O: [261967]
    Other proteins in same PDB: d4rqpb_, d4rqpf_, d4rqpj_, d4rqpn_, d4rqpr_
    automated match to d1pov0_

Details for d4rqpo_

PDB Entry: 4rqp (more details), 3.15 Å

PDB Description: crystal structure of the natually occurring empty particle of a clinical c4 strain ev71
PDB Compounds: (O:) capsid protein VP0

SCOPe Domain Sequences for d4rqpo_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rqpo_ b.121.4.0 (O:) automated matches {Enterovirus a71 [TaxId: 39054]}
vaqltignstittqeaaniivgygewpsycsdsdatavdkptrpdvsvnrfytldtklwe
ksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvavlpeyvi
gtvaggtgtedshppykqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnncat
iivpyinalpfdsalnhcnfgllvvpispldydqgatpvipititlapmcsefaglrq

SCOPe Domain Coordinates for d4rqpo_:

Click to download the PDB-style file with coordinates for d4rqpo_.
(The format of our PDB-style files is described here.)

Timeline for d4rqpo_: