Lineage for d4rosa2 (4ros A:146-319)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1939262Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1939263Protein automated matches [226850] (26 species)
    not a true protein
  7. 1939373Species Methylobacterium extorquens [TaxId:419610] [261962] (2 PDB entries)
  8. 1939375Domain d4rosa2: 4ros A:146-319 [261965]
    Other proteins in same PDB: d4rosa1
    automated match to d3p7ma2
    complexed with apr, ca, oaa

Details for d4rosa2

PDB Entry: 4ros (more details), 1.95 Å

PDB Description: crystal structure of methylobacterium extorquens malate dehydrogenase complexed with oxaloacetate and adenosine-5-diphosphoribose
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4rosa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rosa2 d.162.1.0 (A:146-319) automated matches {Methylobacterium extorquens [TaxId: 419610]}
gvldsarfrhflaeefgvsvedvtafvlgghgddmvpltrystvagvpltdlvklgwttq
ekldamvertrkgggeivnllktgsafyapaasaiamaesylrdkkrvlpcaayldgqyg
idglyvgvpvvigengvervlevtfnddekamfeksvnsvkglieacksvndkl

SCOPe Domain Coordinates for d4rosa2:

Click to download the PDB-style file with coordinates for d4rosa2.
(The format of our PDB-style files is described here.)

Timeline for d4rosa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rosa1