SCOPe 2.05: Domain d4rosa2: 4ros A:146-319

Lineage for d4rosa2 (4ros A:146-319)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (26 species)
   not a true protein

7. Species Methylobacterium extorquens [TaxId:419610] [261962] (2 PDB entries)

8. Domain d4rosa2: 4ros A:146-319 [261965]
   Other proteins in same PDB: d4rosa1
   automated match to d3p7ma2
   complexed with apr, ca, oaa

Details for d4rosa2

PDB Entry: 4ros, 1.95 Å

PDB Description: crystal structure of methylobacterium extorquens malate dehydrogenase complexed with oxaloacetate and adenosine-5-diphosphoribose

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4rosa2:

Sequence; same for both SEQRES and ATOM records:

>d4rosa2 d.162.1.0 (A:146-319) automated matches {Methylobacterium extorquens [TaxId: 419610]}
gvldsarfrhflaeefgvsvedvtafvlgghgddmvpltrystvagvpltdlvklgwttq
ekldamvertrkgggeivnllktgsafyapaasaiamaesylrdkkrvlpcaayldgqyg
idglyvgvpvvigengvervlevtfnddekamfeksvnsvkglieacksvndkl

Timeline for d4rosa2:

• d4rosa2 first appeared in SCOPe 2.04
  
• d4rosa2 appears in SCOPe 2.06
  
• d4rosa2 appears in the current release, SCOPe 2.08