Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (181 species) not a true protein |
Species Methylobacterium extorquens [TaxId:419610] [261958] (2 PDB entries) |
Domain d4rosa1: 4ros A:2-145 [261964] Other proteins in same PDB: d4rosa2 automated match to d3p7md1 complexed with apr, ca, oaa |
PDB Entry: 4ros (more details), 1.95 Å
SCOPe Domain Sequences for d4rosa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rosa1 c.2.1.0 (A:2-145) automated matches {Methylobacterium extorquens [TaxId: 419610]} arskialigagqiggtlahlaglkelgdvvlfdivdgvpqgkaldiaesapvdgfdakys gasdysaiagadvvivtagvprkpgmsrddliginlkvmeavgagikehapdafvicitn pldamvwalqkfsglptnkvvgma
Timeline for d4rosa1: