Lineage for d4rosa1 (4ros A:2-145)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1580999Species Methylobacterium extorquens [TaxId:419610] [261958] (2 PDB entries)
  8. 1581001Domain d4rosa1: 4ros A:2-145 [261964]
    Other proteins in same PDB: d4rosa2
    automated match to d3p7md1
    complexed with apr, ca, oaa

Details for d4rosa1

PDB Entry: 4ros (more details), 1.95 Å

PDB Description: crystal structure of methylobacterium extorquens malate dehydrogenase complexed with oxaloacetate and adenosine-5-diphosphoribose
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4rosa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rosa1 c.2.1.0 (A:2-145) automated matches {Methylobacterium extorquens [TaxId: 419610]}
arskialigagqiggtlahlaglkelgdvvlfdivdgvpqgkaldiaesapvdgfdakys
gasdysaiagadvvivtagvprkpgmsrddliginlkvmeavgagikehapdafvicitn
pldamvwalqkfsglptnkvvgma

SCOPe Domain Coordinates for d4rosa1:

Click to download the PDB-style file with coordinates for d4rosa1.
(The format of our PDB-style files is described here.)

Timeline for d4rosa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4rosa2