SCOPe 2.05: Domain d4rora1: 4ror A:2-145

Lineage for d4rora1 (4ror A:2-145)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Methylobacterium extorquens [TaxId:419610] [261958] (2 PDB entries)

8. Domain d4rora1: 4ror A:2-145 [261960]
   Other proteins in same PDB: d4rora2
   automated match to d3p7md1
   complexed with ca

Details for d4rora1

PDB Entry: 4ror, 1.66 Å

PDB Description: crystal structure of malate dehydrogenase from methylobacterium extorquens

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4rora1:

Sequence; same for both SEQRES and ATOM records:

>d4rora1 c.2.1.0 (A:2-145) automated matches {Methylobacterium extorquens [TaxId: 419610]}
arskialigagqiggtlahlaglkelgdvvlfdivdgvpqgkaldiaesapvdgfdakys
gasdysaiagadvvivtagvprkpgmsrddliginlkvmeavgagikehapdafvicitn
pldamvwalqkfsglptnkvvgma

Timeline for d4rora1:

• d4rora1 first appeared in SCOPe 2.04
  
• d4rora1 appears in SCOPe 2.06
  
• d4rora1 appears in the current release, SCOPe 2.08