Lineage for d4rqpk_ (4rqp K:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431815Family b.121.4.0: automated matches [191569] (1 protein)
    not a true family
  6. 2431816Protein automated matches [190988] (22 species)
    not a true protein
  7. 2431857Species Enterovirus a71 [TaxId:39054] [261947] (13 PDB entries)
  8. 2431876Domain d4rqpk_: 4rqp K: [261956]
    Other proteins in same PDB: d4rqpb_, d4rqpf_, d4rqpj_, d4rqpn_, d4rqpr_
    automated match to d1pov0_

Details for d4rqpk_

PDB Entry: 4rqp (more details), 3.15 Å

PDB Description: crystal structure of the natually occurring empty particle of a clinical c4 strain ev71
PDB Compounds: (K:) capsid protein VP0

SCOPe Domain Sequences for d4rqpk_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rqpk_ b.121.4.0 (K:) automated matches {Enterovirus a71 [TaxId: 39054]}
vaqltignstittqeaaniivgygewpsycsdsdatavdkptrpdvsvnrfytldtklwe
ksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvavlpeyvi
gtvaggtgtedshppykqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnncat
iivpyinalpfdsalnhcnfgllvvpispldydqgatpvipititlapmcsefaglrq

SCOPe Domain Coordinates for d4rqpk_:

Click to download the PDB-style file with coordinates for d4rqpk_.
(The format of our PDB-style files is described here.)

Timeline for d4rqpk_: