![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
![]() | Family b.121.4.0: automated matches [191569] (1 protein) not a true family |
![]() | Protein automated matches [190988] (13 species) not a true protein |
![]() | Species Enterovirus a71 [TaxId:39054] [261947] (8 PDB entries) |
![]() | Domain d4rqpk_: 4rqp K: [261956] Other proteins in same PDB: d4rqpb_, d4rqpf_, d4rqpj_, d4rqpn_, d4rqpr_ automated match to d1pov0_ |
PDB Entry: 4rqp (more details), 3.15 Å
SCOPe Domain Sequences for d4rqpk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rqpk_ b.121.4.0 (K:) automated matches {Enterovirus a71 [TaxId: 39054]} vaqltignstittqeaaniivgygewpsycsdsdatavdkptrpdvsvnrfytldtklwe ksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvavlpeyvi gtvaggtgtedshppykqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnncat iivpyinalpfdsalnhcnfgllvvpispldydqgatpvipititlapmcsefaglrq
Timeline for d4rqpk_: