SCOPe 2.08: Domain d4rqpk_: 4rqp K:

Lineage for d4rqpk_ (4rqp K:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.0: automated matches [191569] (1 protein)
   not a true family

6. Protein automated matches [190988] (51 species)
   not a true protein

7. Species Enterovirus a71 [TaxId:39054] [261947] (13 PDB entries)

8. Domain d4rqpk_: 4rqp K: [261956]
   Other proteins in same PDB: d4rqpb_, d4rqpf_, d4rqpj_, d4rqpn_, d4rqpr_
   automated match to d1pov0_

Details for d4rqpk_

PDB Entry: 4rqp, 3.15 Å

PDB Description: crystal structure of the natually occurring empty particle of a clinical c4 strain ev71

PDB Compounds: (K:) capsid protein VP0

SCOPe Domain Sequences for d4rqpk_:

Sequence; same for both SEQRES and ATOM records:

>d4rqpk_ b.121.4.0 (K:) automated matches {Enterovirus a71 [TaxId: 39054]}
vaqltignstittqeaaniivgygewpsycsdsdatavdkptrpdvsvnrfytldtklwe
ksskgwywkfpdvltetgvfgqnaqfhylyrsgfcihvqcnaskfhqgallvavlpeyvi
gtvaggtgtedshppykqtqpgadgfelqhpyvldagipisqltvcphqwinlrtnncat
iivpyinalpfdsalnhcnfgllvvpispldydqgatpvipititlapmcsefaglrq

Timeline for d4rqpk_:

• d4rqpk_ first appeared in SCOPe 2.04
  
• d4rqpk_ appears in SCOPe 2.07