SCOPe 2.07: Domain d4rqpb_: 4rqp B:

Lineage for d4rqpb_ (4rqp B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
   the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
   there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)

6. Protein automated matches [190854] (25 species)
   not a true protein

7. Species Human enterovirus 71 [TaxId:39054] [195913] (16 PDB entries)

8. Domain d4rqpb_: 4rqp B: [261955]
   Other proteins in same PDB: d4rqpc_, d4rqpg_, d4rqpk_, d4rqpo_
   automated match to d3vbhc_

Details for d4rqpb_

PDB Entry: 4rqp, 3.15 Å

PDB Description: crystal structure of the natually occurring empty particle of a clinical c4 strain ev71

PDB Compounds: (B:) capsid protein vp3

SCOPe Domain Sequences for d4rqpb_:

Sequence, based on SEQRES records:

>d4rqpb_ b.121.4.1 (B:) automated matches {Human enterovirus 71 [TaxId: 39054]}
gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
natslmerlrfpvsaqagkgelcavfradpgrsgpwqstllgqlcgyytqwsgslevtfm
ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah
ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmqlckdasdilqt

Sequence, based on observed residues (ATOM records):

>d4rqpb_ b.121.4.1 (B:) automated matches {Human enterovirus 71 [TaxId: 39054]}
gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt
natslmerlrfpvsaqagkgelcavfradpgrsgpwqstllgqlcgyytqwsgslevtfm
ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisntyttgl
vsiwyqtnyvvpigapntayiialaaaqknftmqlckdasdilqt

Timeline for d4rqpb_:

• d4rqpb_ first appeared in SCOPe 2.04
  
• d4rqpb_ appears in SCOPe 2.06
  
• d4rqpb_ appears in the current release, SCOPe 2.08