Class b: All beta proteins [48724] (176 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins) the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2 there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus) |
Protein automated matches [190854] (9 species) not a true protein |
Species Human enterovirus 71 [TaxId:39054] [195913] (10 PDB entries) |
Domain d4rqpf_: 4rqp F: [261954] Other proteins in same PDB: d4rqpc_, d4rqpg_, d4rqpk_, d4rqpo_ automated match to d3vbhc_ |
PDB Entry: 4rqp (more details), 3.15 Å
SCOPe Domain Sequences for d4rqpf_:
Sequence, based on SEQRES records: (download)
>d4rqpf_ b.121.4.1 (F:) automated matches {Human enterovirus 71 [TaxId: 39054]} gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt natslmerlrfpvsaqagkgelcavfradpgrsgpwqstllgqlcgyytqwsgslevtfm ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisnthyrah ardgvfdyyttglvsiwyqtnyvvpigapntayiialaaaqknftmqlckdasdilqt
>d4rqpf_ b.121.4.1 (F:) automated matches {Human enterovirus 71 [TaxId: 39054]} gfptelkpgtnqflttddgvsapilpnfhptpcihipgevrnllelcqvetilevnnvpt natslmerlrfpvsaqagkgelcavfradpgrsgpwqstllgqlcgyytqwsgslevtfm ftgsfmatgkmliaytppggplpkdratamlgthviwdfglqssvtlvipwisntyttgl vsiwyqtnyvvpigapntayiialaaaqknftmqlckdasdilqt
Timeline for d4rqpf_: