Lineage for d4rc8a_ (4rc8 A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1727563Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1727564Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1729639Family a.25.1.6: PMT1231-like [158402] (2 proteins)
    PfamB PB016165
    automatically mapped to Pfam PF11266
  6. 1729650Protein automated matches [261918] (1 species)
    not a true protein
  7. 1729651Species Synechococcus elongatus [TaxId:1140] [261919] (5 PDB entries)
  8. 1729652Domain d4rc8a_: 4rc8 A: [261940]
    automated match to d4kvqa_
    complexed with fe, ste

Details for d4rc8a_

PDB Entry: 4rc8 (more details), 1.71 Å

PDB Description: Crystal structure of cyanobacterial aldehyde-deformylating oxygenase bound with fatty acid
PDB Compounds: (A:) Aldehyde decarbonylase

SCOPe Domain Sequences for d4rc8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rc8a_ a.25.1.6 (A:) automated matches {Synechococcus elongatus [TaxId: 1140]}
ldfqsesykdaysrinaiviegeqeafdnynrlaemlpdqrdelhklakmeqrhmkgfma
cgknlsvtpdmgfaqkfferlhenfkaaaaegkvvtclliqsliiecfaiaayniyipva
dafarkitegvvrdeylhrnfgeewlkanfdaskaeleeanrqnlplvwlmlnevaddar
elgmereslvedfmiaygealenigfttreimrmsayglaav

SCOPe Domain Coordinates for d4rc8a_:

Click to download the PDB-style file with coordinates for d4rc8a_.
(The format of our PDB-style files is described here.)

Timeline for d4rc8a_: