Lineage for d2hpp.1 (2hpp L:,H:)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 60334Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
  4. 60335Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) (S)
  5. 60420Family b.47.1.2: Eukaryotic proteases [50514] (35 proteins)
  6. 60693Protein Thrombin [50531] (2 species)
  7. 60729Species Human (Homo sapiens) [TaxId:9606] [50532] (116 PDB entries)
  8. 60852Domain d2hpp.1: 2hpp L:,H: [26194]
    Other proteins in same PDB: d2hppp_

Details for d2hpp.1

PDB Entry: 2hpp (more details), 3.3 Å

PDB Description: Structures of the noncovalent complexes of human and bovine prothrombin fragment 2 with human ppack-thrombin

SCOP Domain Sequences for d2hpp.1:

Sequence, based on SEQRES records: (download)

>g2hpp.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens)}
geadcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellcg
aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr
ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwt
anvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpf
vmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf

Sequence, based on observed residues (ATOM records): (download)

>g2hpp.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens)}
geadcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellcg
aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr
ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwg
qpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspf
nnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf

SCOP Domain Coordinates for d2hpp.1:

Click to download the PDB-style file with coordinates for d2hpp.1.
(The format of our PDB-style files is described here.)

Timeline for d2hpp.1: