![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.6: PMT1231-like [158402] (2 proteins) PfamB PB016165 automatically mapped to Pfam PF11266 |
![]() | Protein automated matches [261918] (5 species) not a true protein |
![]() | Species Synechococcus elongatus [TaxId:1140] [261919] (8 PDB entries) |
![]() | Domain d4rc6b_: 4rc6 B: [261939] automated match to d4kvra_ complexed with fe2; mutant |
PDB Entry: 4rc6 (more details), 2.9 Å
SCOPe Domain Sequences for d4rc6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4rc6b_ a.25.1.6 (B:) automated matches {Synechococcus elongatus [TaxId: 1140]} sykdaysrinaiviegeqeafdnynrlaemlpdqrdelhklakmeqrhmkgfmacgknls vtpdmgfaqkfferlhenfkaaaaegkvvtclliqsliiecfaiaafniyipvadafark itegvvrdeylhrnfgeewlkanfdaskaeleeanrqnlplvwlmlnevaddarelgmer eslvedfmiaygealenigfttreimrmsayg
Timeline for d4rc6b_: