SCOPe 2.08: Domain d4r8ea1: 4r8e A:2-251

Lineage for d4r8ea1 (4r8e A:2-251)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (83 species)
   not a true protein

7. Species Yersinia pestis [TaxId:632] [226052] (4 PDB entries)

8. Domain d4r8ea1: 4r8e A:2-251 [261930]
   automated match to d3o04a1

Details for d4r8ea1

PDB Entry: 4r8e, 2.7 Å

PDB Description: crystal structure of beta-ketoacyl-acp synthase ii (fabf) from yersinia pestis

PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier-protein] synthase 2

SCOPe Domain Sequences for d4r8ea1:

Sequence; same for both SEQRES and ATOM records:

>d4r8ea1 c.95.1.0 (A:2-251) automated matches {Yersinia pestis [TaxId: 632]}
krrvvvtglgmlspvgntvestwkavlagqsgislidhfdtsayatrfaglvkdfncedy
isrkdarkmdafiqygvaagmqamqdaglditeanasrigaaigsgigglglieenhtal
vnggprkispffvpstivnmiaghltimyglrgpsisiatactsgvhnighaariiaynd
advmvaggaekastplgvggfgaaralstrndnpqaasrpwdkdrdgfvlgdgagmmvle
eyehakkrga

Timeline for d4r8ea1:

• d4r8ea1 first appeared in SCOPe 2.04
  
• d4r8ea1 appears in SCOPe 2.07