![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins) |
![]() | Protein Thrombin [50531] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [50532] (149 PDB entries) |
![]() | Domain d2hpq.1: 2hpq L:,H: [26193] Other proteins in same PDB: d2hpqp_ complexed with ch2 |
PDB Entry: 2hpq (more details), 3.3 Å
SCOP Domain Sequences for d2hpq.1:
Sequence, based on SEQRES records: (download)
>g2hpq.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens)} geadcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellcg aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwt anvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpf vmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf
>g2hpq.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens)} geadcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellcg aslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlekiyihpr ynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnlketwg qpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspf nnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf
Timeline for d2hpq.1: