Lineage for d4r5fa_ (4r5f A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2130990Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2130991Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2132229Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2132230Protein automated matches [190151] (121 species)
    not a true protein
  7. 2132273Species Archaeoglobus fulgidus [TaxId:224325] [196899] (4 PDB entries)
  8. 2132275Domain d4r5fa_: 4r5f A: [261923]
    automated match to d4eb5a_
    complexed with act, ca, cl, pg4, pmp; mutant

Details for d4r5fa_

PDB Entry: 4r5f (more details), 1.9 Å

PDB Description: x-ray structure of the d199k mutant of the cysteine desulfurase iscs from a. fulgidus
PDB Compounds: (A:) Cysteine desulfurase IscS 2

SCOPe Domain Sequences for d4r5fa_:

Sequence, based on SEQRES records: (download)

>d4r5fa_ c.67.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
ayfdytsakpvderileamlpymtesfgnpssvhsygfkareavqearekvaklvngggg
tvvftsgateannlaiigyamrnarkgkhilvsavehmsvinpakflqkqgfeveyipvg
kygevdvsfidqklrddtilvsvqhanneigtiqpveeisevlagkaalhidatasvgqi
evdvekigadmltissnkiygpkgvgalwirkeaklqpvilgggqenglrsgsenvpsiv
gfgkaaeitamewreeaerlrrlrdriidnvlkieesylnghpekrlpnnvnvrfsyieg
esivlsldmagiqastgsacssktlqpshvlmacglkheeahgtllltlgryntdedvdr
llevlpgvierlrsmsp

Sequence, based on observed residues (ATOM records): (download)

>d4r5fa_ c.67.1.0 (A:) automated matches {Archaeoglobus fulgidus [TaxId: 224325]}
ayfdytsakpvderileamlpymtesfgnpssvhsygfkareavqearekvaklvngggg
tvvftsgateannlaiigyamrnarkgkhilvsavehmsvinpakflqkqgfeveyipvg
kygevdvsfidqklrddtilvsvqhanneigtiqpveeisevlagkaalhidatasvgqi
evdvekigadmltissnkiygpkgvgalwirkeaklqpvilgggqenglrsgsenvpsiv
gfgkaaeitamewreeaerlrrlrdriidnvlkieesylnghpekrlpnnvnvrfsyieg
esivlsldmagiqastgqpshvlmacglkheeahgtllltlgryntdedvdrllevlpgv
ierlrsmsp

SCOPe Domain Coordinates for d4r5fa_:

Click to download the PDB-style file with coordinates for d4r5fa_.
(The format of our PDB-style files is described here.)

Timeline for d4r5fa_: