Lineage for d4r4yb_ (4r4y B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995809Family d.153.1.5: (Glycosyl)asparaginase [56261] (2 proteins)
    automatically mapped to Pfam PF01112
  6. 2995810Protein Glycosylasparaginase (aspartylglucosaminidase, AGA) [56262] (5 species)
    the precursor chain is cleaved onto 2 fragments by autoproteolysis
  7. 2995814Species Elizabethkingia miricola [TaxId:172045] [261921] (1 PDB entry)
  8. 2995816Domain d4r4yb_: 4r4y B: [261922]
    automated match to d1p4ka_
    complexed with sd4; mutant

Details for d4r4yb_

PDB Entry: 4r4y (more details), 2.1 Å

PDB Description: Structural basis of a point mutation that causes the genetic disease Aspartylglucosaminuria
PDB Compounds: (B:) N(4)-(Beta-N-acetylglucosaminyl)-L-asparaginase

SCOPe Domain Sequences for d4r4yb_:

Sequence, based on SEQRES records: (download)

>d4r4yb_ d.153.1.5 (B:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Elizabethkingia miricola [TaxId: 172045]}
ttnkpivlstwnfglhanveawkvlskggkaldavekgvrlveddptersvgyggrpdrd
grvtldacimdenynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkk
enlltaesekewkewlktsqykpivnienhdtigmialdaqgnlsgacttsdmaykmhgr
vgdspiigaglfvdneigaatatghgeevirtvgthlvvelmnqgrtpqqackeaveriv
kivnrrgknlkdiqvgfialnkkgeygayciqdgfnfavhdqkgnrletpgfalk

Sequence, based on observed residues (ATOM records): (download)

>d4r4yb_ d.153.1.5 (B:) Glycosylasparaginase (aspartylglucosaminidase, AGA) {Elizabethkingia miricola [TaxId: 172045]}
ttnkpivlstwnfglhanveawkvlskggkaldavekgvrlvedrpdrdgrvtldacimd
enynigsvacmehiknpisvaravmektphvmlvgdgalefalsqgfkkenlltaeseke
wkewlkttigmialdaqgnlsgacttsdmaykmhgrvgdspiigaglfvdneigaatatg
hgeevirtvgthlvvelmnqgrtpqqackeaverivkivnrrgknlkdiqvgfialnkkg
eygayciqdgfnfavhdqkgnrletpgfalk

SCOPe Domain Coordinates for d4r4yb_:

Click to download the PDB-style file with coordinates for d4r4yb_.
(The format of our PDB-style files is described here.)

Timeline for d4r4yb_: