Lineage for d4qjna_ (4qjn A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2000813Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 2000814Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 2000879Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 2000880Protein automated matches [191007] (8 species)
    not a true protein
  7. 2000905Species Staphylococcus aureus [TaxId:158878] [261909] (1 PDB entry)
  8. 2000906Domain d4qjna_: 4qjn A: [261913]
    automated match to d4dkyb_

Details for d4qjna_

PDB Entry: 4qjn (more details), 2.61 Å

PDB Description: Crystal structure of apo nucleoid associated protein, SAV1473
PDB Compounds: (A:) DNA-binding protein HU

SCOPe Domain Sequences for d4qjna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qjna_ a.55.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 158878]}
mnktdlinavaeqadltkkeagsavdavfesiqnslakgekvqligfgnfevreraarkg
rnpqtgkeidipaskvpafkagkalkdavk

SCOPe Domain Coordinates for d4qjna_:

Click to download the PDB-style file with coordinates for d4qjna_.
(The format of our PDB-style files is described here.)

Timeline for d4qjna_: