Lineage for d4qjnc_ (4qjn C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1737334Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 1737335Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 1737400Family a.55.1.0: automated matches [191573] (1 protein)
    not a true family
  6. 1737401Protein automated matches [191007] (5 species)
    not a true protein
  7. 1737416Species Staphylococcus aureus [TaxId:158878] [261909] (1 PDB entry)
  8. 1737419Domain d4qjnc_: 4qjn C: [261911]
    automated match to d4dkyb_

Details for d4qjnc_

PDB Entry: 4qjn (more details), 2.61 Å

PDB Description: Crystal structure of apo nucleoid associated protein, SAV1473
PDB Compounds: (C:) DNA-binding protein HU

SCOPe Domain Sequences for d4qjnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4qjnc_ a.55.1.0 (C:) automated matches {Staphylococcus aureus [TaxId: 158878]}
mnktdlinavaeqadltkkeagsavdavfesiqnslakgekvqligfgnfevreraarkg
rnpqtgkeidipaskvpafkagkalkdavk

SCOPe Domain Coordinates for d4qjnc_:

Click to download the PDB-style file with coordinates for d4qjnc_.
(The format of our PDB-style files is described here.)

Timeline for d4qjnc_: