Class b: All beta proteins [48724] (141 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (44 proteins) |
Protein Thrombin [50531] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50532] (149 PDB entries) |
Domain d1awh.1: 1awh A:,B: [26191] |
PDB Entry: 1awh (more details), 3 Å
SCOP Domain Sequences for d1awh.1:
Sequence; same for both SEQRES and ATOM records: (download)
>g1awh.1 b.47.1.2 (A:,B:) Thrombin {Human (Homo sapiens)} tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp qellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlek iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn lketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdaceg dsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
Timeline for d1awh.1:
View in 3D Domains from other chains: (mouse over for more information) d1awh.2, d1awh.2, d1awh.2, d1awh.2 |