Lineage for d4q93a_ (4q93 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2105375Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 protein domains)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2105558Protein Tyrosyl-tRNA synthetase (TyrRS) [52376] (6 species)
  7. 2105572Species Human (Homo sapiens) [TaxId:9606] [82355] (6 PDB entries)
  8. 2105575Domain d4q93a_: 4q93 A: [261906]
    automated match to d1n3la_
    complexed with cl, gol, po4, so4, stl

Details for d4q93a_

PDB Entry: 4q93 (more details), 2.1 Å

PDB Description: crystal structure of resveratrol bound human tyrosyl trna synthetase
PDB Compounds: (A:) Tyrosine--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d4q93a_:

Sequence, based on SEQRES records: (download)

>d4q93a_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapiens) [TaxId: 9606]}
apspeeklhlitrnlqevlgeeklkeilkerelkiywgtattgkphvayfvpmskiadfl
kagcevtilfadlhayldnmkapwellelrvsyyenvikamlesigvpleklkfikgtdy
qlskeytldvyrlssvvtqhdskkagaevvkqvehpllsgllypglqaldeeylkvdaqf
ggidqrkiftfaekylpalgyskrvhlmnpmvpgltgskmssseeeskidlldrkedvkk
klkkafcepgnvenngvlsfikhvlfplksefvilrdekwggnktytayvdlekdfaaev
vhpgdlknsvevalnklldpirekfntpalkklasaayp

Sequence, based on observed residues (ATOM records): (download)

>d4q93a_ c.26.1.1 (A:) Tyrosyl-tRNA synthetase (TyrRS) {Human (Homo sapiens) [TaxId: 9606]}
apspeeklhlitrnlqevlgeeklkeilkerelkiywgtattgkphvayfvpmskiadfl
kagcevtilfadlhayldnmkapwellelrvsyyenvikamlesigvpleklkfikgtdy
qlskeytldvyrlssvvtqhdskkagaevvkqvehpllsgllypglqaldeeylkvdaqf
ggidqrkiftfaekylpalgyskrvhlmnpmvpgltgskidlldrkedvkkklkkafcep
gnvenngvlsfikhvlfplksefvilrdekwggnktytayvdlekdfaaevvhpgdlkns
vevalnklldpirekfntpalkklasaayp

SCOPe Domain Coordinates for d4q93a_:

Click to download the PDB-style file with coordinates for d4q93a_.
(The format of our PDB-style files is described here.)

Timeline for d4q93a_: