Lineage for d4q1ea_ (4q1e A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1593544Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1593633Protein Deoxycytidine kinase [89657] (1 species)
  7. 1593634Species Human (Homo sapiens) [TaxId:9606] [89658] (40 PDB entries)
  8. 1593663Domain d4q1ea_: 4q1e A: [261893]
    automated match to d4jlnb_
    complexed with 2y7, 2y8, udp; mutant

Details for d4q1ea_

PDB Entry: 4q1e (more details), 1.85 Å

PDB Description: Human dCK C4S-S74E mutant in complex with UDP and the inhibitor 10 {2-{[(1R/S)-1-{2-[3-(2-fluoroethoxy)-4-methoxyphenyl]-5-methyl-1,3-thiazol 4-yl}ethyl]sulfanyl}pyrimidine-4,6-diamine}
PDB Compounds: (A:) Deoxycytidine kinase

SCOPe Domain Sequences for d4q1ea_:

Sequence, based on SEQRES records: (download)

>d4q1ea_ c.37.1.1 (A:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}
rikkisiegniaagkstfvnilkqlsedwevvpepvarwsnvqstqdefeeltmeqkngg
nvlqmmyekperwsftfqtyaclsriraqlaslngklkdaekpvlffersvysdryifas
nlyesesmnetewtiyqdwhdwmnnqfgqsleldgiiylqatpetclhriylrgrneeqg
ipleyleklhykheswllhrtlktnfdylqevpiltldvnedfkdkyeslvekvkeflst
l

Sequence, based on observed residues (ATOM records): (download)

>d4q1ea_ c.37.1.1 (A:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}
rikkisiegniaagkstfvnilkqlsedwevvpepvarwsnltmeqknggnvlqmmyekp
erwsftfqtyaclsriraqlaslngklkdaekpvlffersvysdryifasnlyesesmne
tewtiyqdwhdwmnnqfgqsleldgiiylqatpetclhriylrgrneeqgipleyleklh
ykheswllhrtlktnfdylqevpiltldvnedfkdkyeslvekvkeflstl

SCOPe Domain Coordinates for d4q1ea_:

Click to download the PDB-style file with coordinates for d4q1ea_.
(The format of our PDB-style files is described here.)

Timeline for d4q1ea_: