Lineage for d1hut.1 (1hut L:,H:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2055629Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2055630Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2055877Family b.47.1.2: Eukaryotic proteases [50514] (49 protein domains)
  6. 2056594Protein Thrombin [50531] (2 species)
  7. 2056630Species Human (Homo sapiens) [TaxId:9606] [50532] (170 PDB entries)
    Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620
  8. 2056814Domain d1hut.1: 1hut L:,H: [26189]
    protein/DNA complex; complexed with 0g7

Details for d1hut.1

PDB Entry: 1hut (more details), 2.9 Å

PDB Description: the structure of alpha-thrombin inhibited by a 15-mer single-stranded dna aptamer
PDB Compounds: (H:) ALPHA-THROMBIN heavy chain, (L:) ALPHA-THROMBIN light chain

SCOPe Domain Sequences for d1hut.1:

Sequence, based on SEQRES records: (download)

>g1hut.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlek
iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn
lketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdaceg
dsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

Sequence, based on observed residues (ATOM records): (download)

>g1hut.1 b.47.1.2 (L:,H:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknftendllvrigkhsrtryerniekismlek
iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn
lketwgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegdsggpf
vmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge

SCOPe Domain Coordinates for d1hut.1:

Click to download the PDB-style file with coordinates for d1hut.1.
(The format of our PDB-style files is described here.)

Timeline for d1hut.1: