Lineage for d4p3dl2 (4p3d L:113-218)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2759993Domain d4p3dl2: 4p3d L:113-218 [261889]
    Other proteins in same PDB: d4p3da_, d4p3dh_
    complexed with cl, edo, epe, gol, mg

Details for d4p3dl2

PDB Entry: 4p3d (more details), 1.95 Å

PDB Description: mt1-mmp:fab complex (form ii)
PDB Compounds: (L:) Light Chain Fab fragment of antibody LEM-2/15

SCOPe Domain Sequences for d4p3dl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p3dl2 b.1.1.0 (L:113-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
raadaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdq
dskdstysmsstltltkdeyerhnsytceathktstspivksfnrn

SCOPe Domain Coordinates for d4p3dl2:

Click to download the PDB-style file with coordinates for d4p3dl2.
(The format of our PDB-style files is described here.)

Timeline for d4p3dl2: