| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d4p3dl2: 4p3d L:113-218 [261889] Other proteins in same PDB: d4p3da_, d4p3dh_ complexed with cl, edo, epe, gol, mg |
PDB Entry: 4p3d (more details), 1.95 Å
SCOPe Domain Sequences for d4p3dl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p3dl2 b.1.1.0 (L:113-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
raadaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdq
dskdstysmsstltltkdeyerhnsytceathktstspivksfnrn
Timeline for d4p3dl2:
View in 3DDomains from other chains: (mouse over for more information) d4p3da_, d4p3db1, d4p3db2, d4p3dh_ |