SCOPe 2.04: Domain d4p3cl2: 4p3c L:121-218

Lineage for d4p3cl2 (4p3c L:121-218)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (388 PDB entries)

8. Domain d4p3cl2: 4p3c L:121-218 [261886]
   automated match to d1a3rl2
   complexed with act, cl, edo, epe, mg

Details for d4p3cl2

PDB Entry: 4p3c, 1.94 Å

PDB Description: mt1-mmp:fab complex (form i)

PDB Compounds: (L:) Light Chain Fab fragment of antibody LEM-2/15

SCOPe Domain Sequences for d4p3cl2:

Sequence; same for both SEQRES and ATOM records:

>d4p3cl2 b.1.1.0 (L:121-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
vsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstys
msstltltkdeyerhnsytceathktstspivksfnrn

Timeline for d4p3cl2:

• d4p3cl2 is new in SCOPe 2.04-stable
  
• d4p3cl2 appears in SCOPe 2.05
  
• d4p3cl2 appears in the current release, SCOPe 2.08