Lineage for d4p3cl1 (4p3c L:1-112)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2344609Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2355236Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2355237Protein automated matches [190740] (24 species)
    not a true protein
  7. 2357727Species Mouse (Mus musculus) [TaxId:10090] [188198] (598 PDB entries)
  8. 2358054Domain d4p3cl1: 4p3c L:1-112 [261885]
    complexed with act, cl, edo, epe, mg

Details for d4p3cl1

PDB Entry: 4p3c (more details), 1.94 Å

PDB Description: mt1-mmp:fab complex (form i)
PDB Compounds: (L:) Light Chain Fab fragment of antibody LEM-2/15

SCOPe Domain Sequences for d4p3cl1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4p3cl1 b.1.1.0 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvglgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshapytfgggtkleik

SCOPe Domain Coordinates for d4p3cl1:

Click to download the PDB-style file with coordinates for d4p3cl1.
(The format of our PDB-style files is described here.)

Timeline for d4p3cl1: