SCOPe 2.08: Domain d4p3cl1: 4p3c L:1-112

Lineage for d4p3cl1 (4p3c L:1-112)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d4p3cl1: 4p3c L:1-112 [261885]
   Other proteins in same PDB: d4p3ch_
   complexed with act, cl, edo, epe, mg

Details for d4p3cl1

PDB Entry: 4p3c, 1.94 Å

PDB Description: mt1-mmp:fab complex (form i)

PDB Compounds: (L:) Light Chain Fab fragment of antibody LEM-2/15

SCOPe Domain Sequences for d4p3cl1:

Sequence; same for both SEQRES and ATOM records:

>d4p3cl1 b.1.1.0 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvglgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshapytfgggtkleik

Timeline for d4p3cl1:

• d4p3cl1 first appeared in SCOPe 2.04
  
• d4p3cl1 appears in SCOPe 2.07