SCOPe 2.04: Domain d4ouul1: 4ouu L:1-112

Lineage for d4ouul1 (4ouu L:1-112)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (19 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (122 PDB entries)

8. Domain d4ouul1: 4ouu L:1-112 [261876]
   Other proteins in same PDB: d4ouua2, d4ouul2
   automated match to d1blna1

Details for d4ouul1

PDB Entry: 4ouu, 2.6 Å

PDB Description: anti-MT1-MMP monoclonal antibody

PDB Compounds: (L:) anti_MT1-MMP light chain

SCOPe Domain Sequences for d4ouul1:

Sequence; same for both SEQRES and ATOM records:

>d4ouul1 b.1.1.1 (L:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvglgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshapytfgggtkleik

Timeline for d4ouul1:

• d4ouul1 is new in SCOPe 2.04-stable
  
• d4ouul1 appears in SCOPe 2.05
  
• d4ouul1 appears in the current release, SCOPe 2.08