Lineage for d4ouua1 (4ouu A:1-112)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2744177Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)
  8. 2744863Domain d4ouua1: 4ouu A:1-112 [261875]
    Other proteins in same PDB: d4ouua2, d4ouul2
    automated match to d1blna1

Details for d4ouua1

PDB Entry: 4ouu (more details), 2.6 Å

PDB Description: anti-MT1-MMP monoclonal antibody
PDB Compounds: (A:) anti_MT1-MMP light chain

SCOPe Domain Sequences for d4ouua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ouua1 b.1.1.1 (A:1-112) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dvlmtqtplslpvglgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshapytfgggtkleik

SCOPe Domain Coordinates for d4ouua1:

Click to download the PDB-style file with coordinates for d4ouua1.
(The format of our PDB-style files is described here.)

Timeline for d4ouua1: