SCOPe 2.08: Domain d4p82a1: 4p82 A:2-179

Lineage for d4p82a1 (4p82 A:2-179)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.61: PRTase-like [53270] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.61.1: PRTase-like [53271] (3 families)

5. Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins)

6. Protein automated matches [190074] (15 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:224308] [261871] (2 PDB entries)

8. Domain d4p82a1: 4p82 A:2-179 [261872]
   Other proteins in same PDB: d4p82a2, d4p82a3
   automated match to d1a3ca_
   complexed with so4

Details for d4p82a1

PDB Entry: 4p82, 1.3 Å

PDB Description: Structure of PyrR protein from Bacillus subtilis

PDB Compounds: (A:) Bifunctional protein PyrR

SCOPe Domain Sequences for d4p82a1:

Sequence; same for both SEQRES and ATOM records:

>d4p82a1 c.61.1.1 (A:2-179) automated matches {Bacillus subtilis [TaxId: 224308]}
nqkavildeqairraltriahemiernkgmnncilvgiktrgiylakrlaerieqiegnp
vtvgeiditlyrddlskktsndeplvkgadipvditdqkvilvddvlytgrtvragmdal
vdvgrpssiqlavlvdrghrelpiradyigkniptsksekvmvqldevdqndlvaiye

Timeline for d4p82a1:

• d4p82a1 first appeared in SCOPe 2.04, called d4p82a_
  
• d4p82a1 appears in SCOPe 2.07