Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
Protein automated matches [190074] (15 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [261871] (2 PDB entries) |
Domain d4p82a1: 4p82 A:2-179 [261872] Other proteins in same PDB: d4p82a2, d4p82a3 automated match to d1a3ca_ complexed with so4 |
PDB Entry: 4p82 (more details), 1.3 Å
SCOPe Domain Sequences for d4p82a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p82a1 c.61.1.1 (A:2-179) automated matches {Bacillus subtilis [TaxId: 224308]} nqkavildeqairraltriahemiernkgmnncilvgiktrgiylakrlaerieqiegnp vtvgeiditlyrddlskktsndeplvkgadipvditdqkvilvddvlytgrtvragmdal vdvgrpssiqlavlvdrghrelpiradyigkniptsksekvmvqldevdqndlvaiye
Timeline for d4p82a1: