![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest |
![]() | Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) ![]() |
![]() | Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins) |
![]() | Protein automated matches [190514] (12 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:1244085] [261371] (2 PDB entries) |
![]() | Domain d4osgd_: 4osg D: [261865] automated match to d3k74a_ complexed with 06u, ca, cac, cl, eoh, nap, peg |
PDB Entry: 4osg (more details), 2.7 Å
SCOPe Domain Sequences for d4osgd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4osgd_ c.71.1.1 (D:) automated matches {Klebsiella pneumoniae [TaxId: 1244085]} misliaalavdrvigmenampwnlpadlawfkrntlnkpvvmgrltwesigrplpgrkni visskpgsddrvqwvssveeaiaacgdveeimvigggrvyeqflpkaqklylthidaeve gdthfpdydpdewesvfsefhdadaqnshsycfeilerr
Timeline for d4osgd_: