Lineage for d4osgd_ (4osg D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2903429Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 2903430Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 2903431Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 2903944Protein automated matches [190514] (12 species)
    not a true protein
  7. 2903953Species Klebsiella pneumoniae [TaxId:1244085] [261371] (2 PDB entries)
  8. 2903958Domain d4osgd_: 4osg D: [261865]
    automated match to d3k74a_
    complexed with 06u, ca, cac, cl, eoh, nap, peg

Details for d4osgd_

PDB Entry: 4osg (more details), 2.7 Å

PDB Description: Klebsiella pneumoniae complexed with NADPH and 6-ethyl-5-[(3R)-3-[3-methoxyl-5-(pyridine-4-yl)phenyl]but-1-yn-1-yl]pyrimidine-2,4-diamine (UCP1006)
PDB Compounds: (D:) dihydrofolate reductase

SCOPe Domain Sequences for d4osgd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4osgd_ c.71.1.1 (D:) automated matches {Klebsiella pneumoniae [TaxId: 1244085]}
misliaalavdrvigmenampwnlpadlawfkrntlnkpvvmgrltwesigrplpgrkni
visskpgsddrvqwvssveeaiaacgdveeimvigggrvyeqflpkaqklylthidaeve
gdthfpdydpdewesvfsefhdadaqnshsycfeilerr

SCOPe Domain Coordinates for d4osgd_:

Click to download the PDB-style file with coordinates for d4osgd_.
(The format of our PDB-style files is described here.)

Timeline for d4osgd_: