Class b: All beta proteins [48724] (176 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins) |
Protein Thrombin [50531] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [50532] (169 PDB entries) Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620 |
Domain d1e0f.3: 1e0f C:,F: [26186] Other proteins in same PDB: d1e0fi_, d1e0fj_, d1e0fk_ |
PDB Entry: 1e0f (more details), 3.1 Å
SCOPe Domain Sequences for d1e0f.3:
Sequence; same for both SEQRES and ATOM records: (download)
>g1e0f.3 b.47.1.2 (C:,F:) Thrombin {Human (Homo sapiens) [TaxId: 9606]} fgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrkspq ellcgaslisdrwvltaahcllyppwdknfiendllvrigkhsrtryerniekismleki yihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgnl ketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdacegd sggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqfge
Timeline for d1e0f.3: