SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d4o9cc2 (4o9c C:271-393)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2146372Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2146373Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2147118Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2147119Protein automated matches [196909] (58 species)
    not a true protein
  7. 2147614Species Ralstonia eutropha [TaxId:381666] [261827] (3 PDB entries)
  8. 2147634Domain d4o9cc2: 4o9c C:271-393 [261848]
    automated match to d4dd5a2
    complexed with coa

Details for d4o9cc2

PDB Entry: 4o9c (more details), 2 Å

PDB Description: Crystal structure of Beta-ketothiolase (PhaA) from Ralstonia eutropha H16
PDB Compounds: (C:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d4o9cc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o9cc2 c.95.1.0 (C:271-393) automated matches {Ralstonia eutropha [TaxId: 381666]}
tplatiksyanagvdpkvmgmgpvpaskralsraewtpqdldlmeineafaaqalavhqq
mgwdtskvnvnggaiaighpigasgcrilvtllhemkrrdakkglaslcigggmgvalav
erk

SCOPe Domain Coordinates for d4o9cc2:

Click to download the PDB-style file with coordinates for d4o9cc2.
(The format of our PDB-style files is described here.)

Timeline for d4o9cc2: