Lineage for d4o9ch1 (4o9c H:1-270)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2523777Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2523778Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2524590Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2524591Protein automated matches [196909] (81 species)
    not a true protein
  7. 2525445Species Ralstonia eutropha [TaxId:381666] [261827] (3 PDB entries)
  8. 2525474Domain d4o9ch1: 4o9c H:1-270 [261845]
    automated match to d4dd5a1
    complexed with coa

Details for d4o9ch1

PDB Entry: 4o9c (more details), 2 Å

PDB Description: crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16
PDB Compounds: (H:) Acetyl-CoA acetyltransferase

SCOPe Domain Sequences for d4o9ch1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o9ch1 c.95.1.0 (H:1-270) automated matches {Ralstonia eutropha [TaxId: 381666]}
mtdvvivsaartavgkfggslakipapelgavvikaaleragvkpeqvsevimgqvltag
sgqnparqaaikaglpamvpamtinkvsgsglkavmlaanaimagdaeivvaggqenmsa
aphvlpgsrdgfrmgdaklvdtmivdglwdvynqyhmgitaenvakeygitreaqdefav
gsqnkaeaaqkagkfdeeivpvlipqrkgdpvafktdefvrqgatldsmsglkpafdkag
tvtaanasglndgaaavvvmsaakakelgl

SCOPe Domain Coordinates for d4o9ch1:

Click to download the PDB-style file with coordinates for d4o9ch1.
(The format of our PDB-style files is described here.)

Timeline for d4o9ch1: