SCOP 1.69: Domain d1e0f.1: 1e0f A:,D:

Lineage for d1e0f.1 (1e0f A:,D:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (46 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (155 PDB entries)

8. Domain d1e0f.1: 1e0f A:,D: [26184]
   Other proteins in same PDB: d1e0fi_, d1e0fj_, d1e0fk_

Details for d1e0f.1

PDB Entry: 1e0f, 3.1 Å

PDB Description: crystal structure of the human alpha-thrombin-haemadin complex: an exosite ii-binding inhibitor

SCOP Domain Sequences for d1e0f.1:

Sequence; same for both SEQRES and ATOM records:

>g1e0f.1 b.47.1.2 (A:,D:) Thrombin {Human (Homo sapiens)}
tfgsgeadcglrplfekksledkterellesyidgrXivegsdaeigmspwqvmlfrksp
qellcgaslisdrwvltaahcllyppwdknfiendllvrigkhsrtryerniekismlek
iyihprynwrenldrdialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgn
lketwtanvgkgqpsvlqvvnlpiverpvckdstriritdnmfcagykpdegkrgdaceg
dsggpfvmkspfnnrwyqmgivswgegcdrdgkygfythvfrlkkwiqkvidqf

Timeline for d1e0f.1:

• d1e0f.1 first appeared (with stable ids) in SCOP 1.55
  
• d1e0f.1 appears in SCOP 1.67
  
• d1e0f.1 appears in SCOP 1.71
  
• d1e0f.1 appears in the current release, SCOPe 2.08