SCOPe 2.05: Domain d4o0ia1: 4o0i A:297-468

Lineage for d4o0ia1 (4o0i A:297-468)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.0: automated matches [191357] (1 protein)
   not a true family

6. Protein automated matches [190396] (30 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [255224] (2 PDB entries)

8. Domain d4o0ia1: 4o0i A:297-468 [261824]
   Other proteins in same PDB: d4o0ia2
   automated match to d4dqqd1
   protein/DNA complex; complexed with gol, na, so4

Details for d4o0ia1

PDB Entry: 4o0i, 2.2 Å

PDB Description: crystal structure of fragment dna polymerase i from bacillus stearothermophilus with 2'-mese-arabino-guanosine derivatized dna

PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d4o0ia1:

Sequence; same for both SEQRES and ATOM records:

>d4o0ia1 c.55.3.0 (A:297-468) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
skmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d4o0ia1:

• d4o0ia1 first appeared in SCOPe 2.04
  
• d4o0ia1 appears in SCOPe 2.06
  
• d4o0ia1 appears in the current release, SCOPe 2.08