SCOPe 2.04: Domain d4nd4a1: 4nd4 A:17-164

Lineage for d4nd4a1 (4nd4 A:17-164)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (6 species)
   not a true protein

7. Species Cryptosporidium parvum [TaxId:353152] [261793] (5 PDB entries)

8. Domain d4nd4a1: 4nd4 A:17-164 [261818]
   Other proteins in same PDB: d4nd4a2, d4nd4b2
   automated match to d2ewda1
   complexed with gol, nad, pyr

Details for d4nd4a1

PDB Entry: 4nd4, 2.2 Å

PDB Description: crystal structure of the lactate dehydrogenase from cryptosporidium parvum complexed with substrate (pyruvic acid) and cofactor (b- nicotinamide adenine dinucleotide)

PDB Compounds: (A:) Lactate dehydrogenase, adjacent gene encodes predicted malate dehydrogenase

SCOPe Domain Sequences for d4nd4a1:

Sequence; same for both SEQRES and ATOM records:

>d4nd4a1 c.2.1.5 (A:17-164) automated matches {Cryptosporidium parvum [TaxId: 353152]}
mierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstsk
vigtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvici
tnpldvmvshfqkvsglphnkvcgma

Timeline for d4nd4a1:

• d4nd4a1 appears in periodic updates to SCOPe 2.04 starting on 2014-12-17
  
• d4nd4a1 appears in SCOPe 2.05
  
• d4nd4a1 appears in the current release, SCOPe 2.08