Lineage for d4nd2a2 (4nd2 A:165-333)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1680346Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1680347Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1680348Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 1680640Protein automated matches [226882] (8 species)
    not a true protein
  7. 1680641Species Cryptosporidium parvum [TaxId:353152] [261800] (5 PDB entries)
  8. 1680642Domain d4nd2a2: 4nd2 A:165-333 [261813]
    Other proteins in same PDB: d4nd2a1, d4nd2b1
    automated match to d2ewda2
    complexed with a3d, gol, pyr

Details for d4nd2a2

PDB Entry: 4nd2 (more details), 2 Å

PDB Description: crystal structure of the lactate dehydrogenase from cryptosporidium parvum complexed with substrate (pyruvic acid) and cofactor analog (3-acetylpyridine adenine dinucleotide)
PDB Compounds: (A:) Lactate dehydrogenase, adjacent gene encodes predicted malate dehydrogenase

SCOPe Domain Sequences for d4nd2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4nd2a2 d.162.1.1 (A:165-333) automated matches {Cryptosporidium parvum [TaxId: 353152]}
gvldssrfrtfiaqhfgvnasdvsanvigghgdgmvpatssvsvggvplssfikqglitq
eqideivchtriawkevadnlktgtayfapaaaavkmaeaylkdkkavvpcsafcsnhyg
vkgiymgvptiigkngvedileldltpleqkllgesinevntiskvldnap

SCOPe Domain Coordinates for d4nd2a2:

Click to download the PDB-style file with coordinates for d4nd2a2.
(The format of our PDB-style files is described here.)

Timeline for d4nd2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4nd2a1