Lineage for d4nd5d1 (4nd5 D:18-164)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2105555Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2105594Protein Lactate dehydrogenase [51859] (18 species)
  7. 2105619Species Cryptosporidium parvum [TaxId:5807] [225185] (10 PDB entries)
  8. 2105633Domain d4nd5d1: 4nd5 D:18-164 [261799]
    Other proteins in same PDB: d4nd5a2, d4nd5b2, d4nd5c2, d4nd5d2
    automated match to d2ewda1

Details for d4nd5d1

PDB Entry: 4nd5 (more details), 2.1 Å

PDB Description: crystal structure of the lactate dehydrogenase from cryptosporidium parvum
PDB Compounds: (D:) Lactate dehydrogenase, adjacent gene encodes predicted malate dehydrogenase

SCOPe Domain Sequences for d4nd5d1:

Sequence, based on SEQRES records: (download)

>d4nd5d1 c.2.1.5 (D:18-164) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]}
ierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstskv
igtndyadisgsdvviitasipgrpkddrsellfgnarildsvaegvkkycpnafvicit
npldvmvshfqkvsglphnkvcgma

Sequence, based on observed residues (ATOM records): (download)

>d4nd5d1 c.2.1.5 (D:18-164) Lactate dehydrogenase {Cryptosporidium parvum [TaxId: 5807]}
ierrkiavigsgqiggniayivgkdnladvvlfdiaegipqgkaldithsmvmfgstskv
igtndyadisgsdvviitallfgnarildsvaegvkkycpnafvicitnpldvmvshfqk
vsglphnkvcgma

SCOPe Domain Coordinates for d4nd5d1:

Click to download the PDB-style file with coordinates for d4nd5d1.
(The format of our PDB-style files is described here.)

Timeline for d4nd5d1: