Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families) |
Family d.58.7.0: automated matches [191529] (1 protein) not a true family |
Protein automated matches [190896] (11 species) not a true protein |
Species Barley (Hordeum vulgare) [TaxId:4513] [261791] (1 PDB entry) |
Domain d2mpua_: 2mpu A: [261792] automated match to d4c7qa_ |
PDB Entry: 2mpu (more details)
SCOPe Domain Sequences for d2mpua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2mpua_ d.58.7.0 (A:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]} maesdgaeyrcfvgslswntddrgleaafssfgeildakiindretgrsrgfgfvsfsne qamqdaiegmngkeldgrsivvneaqsrgygg
Timeline for d2mpua_: