SCOPe 2.06: Domain d2mpua_: 2mpu A:

Lineage for d2mpua_ (2mpu A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (11 species)
   not a true protein

7. Species Barley (Hordeum vulgare) [TaxId:4513] [261791] (1 PDB entry)

8. Domain d2mpua_: 2mpu A: [261792]
   automated match to d4c7qa_

Details for d2mpua_

PDB Entry: 2mpu

PDB Description: Structural and Functional analysis of the Hordeum vulgare L. HvGR-RBP1 protein, a glycine-rich RNA binding protein implicated in the regulation of barley leaf senescence and environmental adaptation

PDB Compounds: (A:) rbp1

SCOPe Domain Sequences for d2mpua_:

Sequence; same for both SEQRES and ATOM records:

>d2mpua_ d.58.7.0 (A:) automated matches {Barley (Hordeum vulgare) [TaxId: 4513]}
maesdgaeyrcfvgslswntddrgleaafssfgeildakiindretgrsrgfgfvsfsne
qamqdaiegmngkeldgrsivvneaqsrgygg

Timeline for d2mpua_:

• d2mpua_ first appeared in SCOPe 2.04
  
• d2mpua_ appears in SCOPe 2.05
  
• d2mpua_ appears in SCOPe 2.07
  
• d2mpua_ appears in the current release, SCOPe 2.08