Lineage for d4knra1 (4knr A:4-251)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2899284Family c.68.1.0: automated matches [191551] (1 protein)
    not a true family
  6. 2899285Protein automated matches [190951] (34 species)
    not a true protein
  7. 2899347Species Haemophilus influenzae [TaxId:727] [231294] (14 PDB entries)
  8. 2899359Domain d4knra1: 4knr A:4-251 [261785]
    Other proteins in same PDB: d4knra2
    automated match to d2v0ha1
    complexed with 1s8, mg, pg4, so4

Details for d4knra1

PDB Entry: 4knr (more details), 2.1 Å

PDB Description: Hin GlmU bound to WG188
PDB Compounds: (A:) Bifunctional protein glmU

SCOPe Domain Sequences for d4knra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4knra1 c.68.1.0 (A:4-251) automated matches {Haemophilus influenzae [TaxId: 727]}
kalsavilaagkgtrmysdlpkvlhtiagkpmvkhvidtahqlgsenihliyghggdlmr
thlaneqvnwvlqteqlgtahavqqaapffkdnenivvlygdaplitketleklieakpe
ngialltvnldnptgygriirengnvvaiveqkdanaeqlnikevntgvmvsdgasfkkw
larvgnnnaqgeyyltdlialanqdncqvvavqatdvmevegannrlqlaaleryfqnkq
askllleg

SCOPe Domain Coordinates for d4knra1:

Click to download the PDB-style file with coordinates for d4knra1.
(The format of our PDB-style files is described here.)

Timeline for d4knra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4knra2