Lineage for d4lmab_ (4lma B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1621089Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1621090Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1621375Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 1621376Protein automated matches [190215] (21 species)
    not a true protein
  7. 1621427Species Microcystis aeruginosa [TaxId:267872] [257035] (2 PDB entries)
  8. 1621430Domain d4lmab_: 4lma B: [261782]
    automated match to d4aira_
    complexed with mpd, plp

Details for d4lmab_

PDB Entry: 4lma (more details), 2.3 Å

PDB Description: Crystal structure analysis of O-acetylserine sulfhydrylase CysK1 from Microcystis aeruginosa 7806
PDB Compounds: (B:) Cysteine synthase

SCOPe Domain Sequences for d4lmab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4lmab_ c.79.1.0 (B:) automated matches {Microcystis aeruginosa [TaxId: 267872]}
mriahdvtelvgrtplvqlnripqaegclgrivmklegmnpaasvkdrigthminsaeka
glinpettvlveptsgntgialamtaaakgyrliltmpetmslerramlkaygatleltp
gsqgmkgailraqqivdsipgaymlqqfrnpsnpeihrlttaeeiwqdtegqvdfivagv
gtggtitgvaeviksrkpsfqvvavepfnspvisggnpgphkiqgigagfipevlrtdli
devitvsdeeafqfgrrlakeegllsgissganlcaaiqlaqrpenegklivviqpsfge
rylstlmfqnie

SCOPe Domain Coordinates for d4lmab_:

Click to download the PDB-style file with coordinates for d4lmab_.
(The format of our PDB-style files is described here.)

Timeline for d4lmab_: