SCOPe 2.01: Domain d2hnt.1: 2hnt L:,C:,E:,F:

Lineage for d2hnt.1 (2hnt L:,C:,E:,F:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)

6. Protein Thrombin [50531] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50532] (160 PDB entries)
   Uniprot P00734 331-361,364-421 ! Uniprot P00734 334-360 364-510 518-619 ! Uniprot P00734 328-620 ! Uniprot P00734 355-621 ! Uniprot P00734 328-620

8. Domain d2hnt.1: 2hnt L:,C:,E:,F: [26178]

Details for d2hnt.1

PDB Entry: 2hnt, 2.5 Å

PDB Description: crystallographic structure of human gamma-thrombin

PDB Compounds: (C:) gamma-thrombin, (E:) gamma-thrombin, (F:) gamma-thrombin, (L:) gamma-thrombin

SCOPe Domain Sequences for d2hnt.1:

Sequence; same for both SEQRES and ATOM records:

>g2hnt.1 b.47.1.2 (L:,C:,E:,F:) Thrombin {Human (Homo sapiens) [TaxId: 9606]}
adcglrplfekksledkterellesyidXivegsdaeigmspwqvmlfrkspqellcgas
lisdrwvltaahcllyppwdknftendllvrigkhsXekismlekiyihprynwrenldr
dialmklkkpvafsdyihpvclpdretaasllqagykgrvtgwgXpsvlqvvnlpiverp
vckdstriritdnmfcagykpdegkrgdacegdsggpfvmkspfnnrwyqmgivswgegc
drdgkygfythvfrlkkwiqkvidq

Timeline for d2hnt.1:

• d2hnt.1 first appeared (with stable ids) in SCOP 1.55
  
• d2hnt.1 appears in SCOP 1.75
  
• d2hnt.1 appears in SCOPe 2.02
  
• d2hnt.1 appears in the current release, SCOPe 2.08