Lineage for d4jz4a_ (4jz4 A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1783288Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1783415Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1783856Family b.34.2.0: automated matches [191375] (1 protein)
    not a true family
  6. 1783857Protein automated matches [190457] (8 species)
    not a true protein
  7. 1783887Species Chicken (Gallus gallus) [TaxId:9031] [225620] (11 PDB entries)
  8. 1783896Domain d4jz4a_: 4jz4 A: [261779]
    automated match to d1e6ga_
    complexed with epe, ni

Details for d4jz4a_

PDB Entry: 4jz4 (more details), 1.56 Å

PDB Description: Crystal structure of chicken c-Src-SH3 domain: monomeric form
PDB Compounds: (A:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4jz4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4jz4a_ b.34.2.0 (A:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gshmtfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

SCOPe Domain Coordinates for d4jz4a_:

Click to download the PDB-style file with coordinates for d4jz4a_.
(The format of our PDB-style files is described here.)

Timeline for d4jz4a_: