SCOPe 2.04: Domain d4jz4b_: 4jz4 B:

Lineage for d4jz4b_ (4jz4 B:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.2: SH3-domain [50044] (2 families)

5. Family b.34.2.0: automated matches [191375] (1 protein)
   not a true family

6. Protein automated matches [190457] (8 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [225620] (7 PDB entries)

8. Domain d4jz4b_: 4jz4 B: [261778]
   automated match to d1e6ga_
   complexed with epe, ni

Details for d4jz4b_

PDB Entry: 4jz4, 1.56 Å

PDB Description: Crystal structure of chicken c-Src-SH3 domain: monomeric form

PDB Compounds: (B:) Proto-oncogene tyrosine-protein kinase Src

SCOPe Domain Sequences for d4jz4b_:

Sequence, based on SEQRES records:

>d4jz4b_ b.34.2.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gshmtfvalydyesrtetdlsfkkgerlqivnntegdwwlahslttgqtgyipsnyvaps

Sequence, based on observed residues (ATOM records):

>d4jz4b_ b.34.2.0 (B:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gshmtfvalydyesrtetdlsfkkgerlqivnngdwwlahslttgqtgyipsnyvaps

Timeline for d4jz4b_:

• d4jz4b_ is new in SCOPe 2.04-stable
  
• d4jz4b_ appears in SCOPe 2.05
  
• d4jz4b_ appears in the current release, SCOPe 2.08, called d4jz4b1