Lineage for d4d19a2 (4d19 A:137-296)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1662613Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 1662614Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 1662861Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. 1663066Protein automated matches [254656] (2 species)
    not a true protein
  7. 1663132Species Aspergillus flavus [TaxId:5059] [260668] (4 PDB entries)
  8. 1663138Domain d4d19a2: 4d19 A:137-296 [261775]
    automated match to d4n9sa2
    complexed with iup, mpd, oxy, urc

Details for d4d19a2

PDB Entry: 4d19 (more details), 1.35 Å

PDB Description: crystal structure of cofactor-free urate oxidase in complex with its 5-peroxoisourate intermediate (x-ray dose, 1.75 mgy)
PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d4d19a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4d19a2 d.96.1.4 (A:137-296) automated matches {Aspergillus flavus [TaxId: 5059]}
gkgidiksslsgltvlkstnsqfwgflrdeyttlketwdrilstdvdatwqwknfsglqe
vrshvpkfdatwatarevtlktfaednsasvqatmykmaeqilarqqlietveyslpnkh
yfeidlswhkglqntgknaevfapqsdpnglikctvgrss

SCOPe Domain Coordinates for d4d19a2:

Click to download the PDB-style file with coordinates for d4d19a2.
(The format of our PDB-style files is described here.)

Timeline for d4d19a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4d19a1