SCOPe 2.08: Domain d4d13a1: 4d13 A:1-136

Lineage for d4d13a1 (4d13 A:1-136)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.96: T-fold [55619] (2 superfamilies)
   beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
   tunnel-shaped: its known members form wide oligomeric barrels different sizes

4. Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families)
   bind purine or pterin in topologically similar sites between subunits

5. Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
   automatically mapped to Pfam PF01014

6. Protein automated matches [254656] (4 species)
   not a true protein

7. Species Aspergillus flavus [TaxId:5059] [260668] (5 PDB entries)

8. Domain d4d13a1: 4d13 A:1-136 [261772]
   automated match to d4n9sa1
   complexed with iup, mpd

Details for d4d13a1

PDB Entry: 4d13, 1.3 Å

PDB Description: crystal structure of cofactor-free urate oxidase in complex with its 5-peroxoisourate intermediate (x-ray dose, 2.2 kgy)

PDB Compounds: (A:) Uricase

SCOPe Domain Sequences for d4d13a1:

Sequence; same for both SEQRES and ATOM records:

>d4d13a1 d.96.1.4 (A:1-136) automated matches {Aspergillus flavus [TaxId: 5059]}
savkaarygkdnvrvykvhkdektgvqtvyemtvcvllegeietsytkadnsvivatdsi
kntiyitakqnpvtppelfgsilgthfiekynhihaahvnivchrwtrmdidgkphphsf
irdseekrnvqvdvve

Timeline for d4d13a1:

• d4d13a1 first appeared in SCOPe 2.04
  
• d4d13a1 appears in SCOPe 2.07