Lineage for d4czoa_ (4czo A:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1741311Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 1741312Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 1741313Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 1741620Protein automated matches [190089] (9 species)
    not a true protein
  7. 1741653Species Ceriporiopsis subvermispora [TaxId:42742] [261492] (5 PDB entries)
  8. 1741655Domain d4czoa_: 4czo A: [261771]
    automated match to d1mnpa_
    complexed with ca, hem, mn

Details for d4czoa_

PDB Entry: 4czo (more details), 1.2 Å

PDB Description: Crystal structure of the extralong fungal manganese peroxidase from Ceriporiopsis subvermispora in complex with manganese
PDB Compounds: (A:) extralong manganese peroxidase

SCOPe Domain Sequences for d4czoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4czoa_ a.93.1.1 (A:) automated matches {Ceriporiopsis subvermispora [TaxId: 42742]}
ptavcsdgtrvsnavccdfvslgqdlqsmvlqgdcgedaheiirltfhdavaisrklgps
agggadgsmllfplvepefaasngiddsvnnlipflslhptisagdlvqfagavalsncp
gaprvqflagrpnhtiaaidglipepqdnvtsilerfddaggftpfevvsllashtiara
dkvdptldaapfdttpftfdsqiflevllkgvgfpgldnntgevssplplgdtstggkdt
glmrlqsdfalahdprtacfwqgfvdqqefmsqsfasafaklavlghntddlidcsevvp
vpkpavdkpttfpattgpqdlelsclaerfptlsvdpgaqetliphcsdglenctsvqfs
gpatdsp

SCOPe Domain Coordinates for d4czoa_:

Click to download the PDB-style file with coordinates for d4czoa_.
(The format of our PDB-style files is described here.)

Timeline for d4czoa_: