SCOPe 2.08: Domain d4czoa1: 4czo A:2-365

Lineage for d4czoa1 (4czo A:2-365)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein automated matches [190089] (9 species)
   not a true protein

7. Species Ceriporiopsis subvermispora [TaxId:42742] [261492] (5 PDB entries)

8. Domain d4czoa1: 4czo A:2-365 [261771]
   Other proteins in same PDB: d4czoa2
   automated match to d1mnpa_
   complexed with ca, hem, mn

Details for d4czoa1

PDB Entry: 4czo, 1.2 Å

PDB Description: Crystal structure of the extralong fungal manganese peroxidase from Ceriporiopsis subvermispora in complex with manganese

PDB Compounds: (A:) extralong manganese peroxidase

SCOPe Domain Sequences for d4czoa1:

Sequence; same for both SEQRES and ATOM records:

>d4czoa1 a.93.1.1 (A:2-365) automated matches {Ceriporiopsis subvermispora [TaxId: 42742]}
vcsdgtrvsnavccdfvslgqdlqsmvlqgdcgedaheiirltfhdavaisrklgpsagg
gadgsmllfplvepefaasngiddsvnnlipflslhptisagdlvqfagavalsncpgap
rvqflagrpnhtiaaidglipepqdnvtsilerfddaggftpfevvsllashtiaradkv
dptldaapfdttpftfdsqiflevllkgvgfpgldnntgevssplplgdtstggkdtglm
rlqsdfalahdprtacfwqgfvdqqefmsqsfasafaklavlghntddlidcsevvpvpk
pavdkpttfpattgpqdlelsclaerfptlsvdpgaqetliphcsdglenctsvqfsgpa
tdsp

Timeline for d4czoa1:

• d4czoa1 first appeared in SCOPe 2.04, called d4czoa_
  
• d4czoa1 was called d4czoa_ in SCOPe 2.07